PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G046700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 315aa    MW: 36010.1 Da    PI: 6.9087
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G046700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.32.1e-51131411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGf+F Ptdeel+ +yL +kv++k++ +  vi ev++yk+ePw+Lp k k++++ekewyf+++rd+ky+tg+ +nratk+gyWk +gkd
  Brast06G046700.1.p  13 LAPGFKFYPTDEELIRFYLIPKVTDKSFCT-PVIGEVNMYKCEPWELPmKaKMAGQEKEWYFYCHRDRKYPTGRMSNRATKAGYWKGSGKD 102
                         579************************888.89**************95247777999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ke+++ +g lvg+kktL+fy+grap+gekt+Wvmheyr 
  Brast06G046700.1.p 103 KEIYHGHGLLVGMKKTLIFYQGRAPNGEKTNWVMHEYRT 141
                         *****9*******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-577176IPR003441NAC domain
PROSITE profilePS5100555.37213176IPR003441NAC domain
PfamPF023651.1E-2515140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGDHLHQQQQ LDLAPGFKFY PTDEELIRFY LIPKVTDKSF CTPVIGEVNM YKCEPWELPM  60
KAKMAGQEKE WYFYCHRDRK YPTGRMSNRA TKAGYWKGSG KDKEIYHGHG LLVGMKKTLI  120
FYQGRAPNGE KTNWVMHEYR TKSNNDNKMP SYTTNGTINT SSNYESEWVV CRIFHKSSGI  180
KKDEVPSYPM DPIINEHISM PMSMPMGDQQ QGFDSEIVVS KIQLPPLMDH FSMYRLDGSV  240
GSSLLAPPFF GNNQGLPMPF YQQHMQMPTK VDEGHLVTTV SRPSSMVSEG DTEAATAADI  300
WPVFQMGMEG MWMY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-4721821171NO APICAL MERISTEM PROTEIN
1ut4_B4e-4721821171NO APICAL MERISTEM PROTEIN
1ut7_A4e-4721821171NO APICAL MERISTEM PROTEIN
1ut7_B4e-4721821171NO APICAL MERISTEM PROTEIN
4dul_A4e-4721821171NAC domain-containing protein 19
4dul_B4e-4721821171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559931.11e-170PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLR32e-68NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0Q3KVA01e-170A0A0Q3KVA0_BRADI; Uncharacterized protein
STRINGMLOC_56943.21e-77(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.22e-66NAC domain containing protein 80